PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr021138.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family NAC
Protein Properties Length: 350aa    MW: 39978.9 Da    PI: 8.1186
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr021138.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM160.85.5e-50131401128
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.kg 97 
                  lp+GfrFhP+deel+v+yLk+kv++ +l++ ++i+e+d+yk++Pw+Lp k++ +e+ewyfF++rd+ky++g+r+nra+  gyWkatg+dk+++s+ ++
  Pbr021138.1  13 LPAGFRFHPSDEELIVHYLKNKVTSCPLPA-TIITELDLYKYNPWELPPKASFGEEEWYFFTPRDRKYPNGSRPNRAAGLGYWKATGTDKHIFSScGT 109
                  799***************************.89**************97778899***************************************9888 PP

          NAM  98 elvglkktLvfykgrapkgektdWvmheyrl 128
                  + +g+kk Lvfy+g+ pkg+kt+W+m+eyrl
  Pbr021138.1 110 KSIGVKKALVFYTGHPPKGVKTEWIMNEYRL 140
                  89***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.27E-605167IPR003441NAC domain
PROSITE profilePS5100557.49613167IPR003441NAC domain
PfamPF023651.8E-2514140IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 350 aa     Download sequence    Send to blast
MERENQATEN IQLPAGFRFH PSDEELIVHY LKNKVTSCPL PATIITELDL YKYNPWELPP  60
KASFGEEEWY FFTPRDRKYP NGSRPNRAAG LGYWKATGTD KHIFSSCGTK SIGVKKALVF  120
YTGHPPKGVK TEWIMNEYRL LDTTMWTSKQ KGSMRLDDWV LCRVRQKCNN TRSIWEDQNS  180
PPSYKLGAYT KQVDDPCSND TNPSIEMVRN YLYKDCPMLP YIFASPELPY AKSFQGTGNT  240
KSCSTSLHEN NSNKTNELLL VSSRDDLINP LKRKPTEGNG YKSFVTPSKR ICSRDYKEEE  300
VNSSTSRDCR AMNLWGVDQS GSADNNLNAD QWSSMIQYQE LSQLIGFQV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-6611693170Stress-induced transcription factor NAC1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009377421.10.0PREDICTED: NAC transcription factor 29-like
TrEMBLM5WDR20.0M5WDR2_PRUPE; Uncharacterized protein
STRINGVIT_08s0040g02110.t011e-139(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF24162981
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G61110.12e-79NAC domain containing protein 25